PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01010.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 327aa    MW: 35266.1 Da    PI: 7.0114
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01010.1_g00010.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.61.7e-191358147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             +g+W++eEd+ll  +v+++G+++W++I++ ++ gR++k+c++rw + 
  Rsa1.0_01010.1_g00010.1 13 KGPWSPEEDDLLQSLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 58
                             79******************************.***********985 PP

2Myb_DNA-binding54.92e-1767109347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              ++T+eEde +++a++++G++ W+tI+r ++ gRt++ +k++w++ 
  Rsa1.0_01010.1_g00010.1  67 AFTAEEDETIIRAHARFGNK-WATISRLLN-GRTDNAIKNHWNST 109
                              79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.679863IPR017930Myb domain
SuperFamilySSF466891.54E-3110106IPR009057Homeodomain-like
SMARTSM007173.4E-171261IPR001005SANT/Myb domain
PfamPF002491.7E-191358IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-261466IPR009057Homeodomain-like
CDDcd001672.34E-161557No hitNo description
SMARTSM007171.7E-1464112IPR001005SANT/Myb domain
PROSITE profilePS5129420.47565114IPR017930Myb domain
PfamPF002499.2E-1567109IPR001005SANT/Myb domain
CDDcd001679.00E-1267110No hitNo description
Gene3DG3DSA:1.10.10.602.3E-2267113IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MSGPSRKNME RIKGPWSPEE DDLLQSLVQK HGPRNWSLIS KSIPGRSGKS CRLRWCNQLS  60
PEVEHRAFTA EEDETIIRAH ARFGNKWATI SRLLNGRTDN AIKNHWNSTL KRKCSAFTSD  120
GQSCDFGGNG GYDGNLGEEQ PLKRTASGGG VSTGLYMSPG SPSGSDVSEQ SSGAPHVFKP  180
TARSGAVPEV TASTSGEDPP TYLSLSLPWN NRCETETVRV NEPTQVNENT VIDGGYTAEL  240
FPVRKEEVEE EKGISGFGGE FMTVVQEMIR TEVRSYMADL QRGNVAGGGS SGGSGGGGGS  300
CMPQSVNSRR VGFREFIVKQ IGIGKSE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-40101131104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667420.0KC966742.1 Brassica napus MYB transcription factor 73 (MYB73.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013722995.10.0PREDICTED: transcription factor MYB44 isoform X1
SwissprotQ9FDW13e-95MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D3A1B40.0A0A0D3A1B4_BRAOL; Uncharacterized protein
STRINGBra011749.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.10.0myb domain protein 73